PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0637
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 476aa    MW: 53456.4 Da    PI: 6.4448
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0637genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-132367348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l   + ++G+++W+ Ia+++   +t  qc+ rw++yl
      Gh_A13G0637 23 TWTQEEDDILRGQISLHGTENWAIIASKFK-DKTTRQCRRRWYTYL 67
                     6****************************9.*************97 PP

2Myb_DNA-binding42.71.3e-1373116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
      Gh_A13G0637  73 KGGWSPEEDMLLCEAQKVFGNR-WTEIAKVVS-GRTDNAVKNRFST 116
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5921667IPR017930Myb domain
SuperFamilySSF466891.54E-2520114IPR009057Homeodomain-like
SMARTSM007176.4E-122069IPR001005SANT/Myb domain
CDDcd001679.47E-122367No hitNo description
Gene3DG3DSA:1.10.10.605.1E-202475IPR009057Homeodomain-like
PfamPF139212.0E-152484No hitNo description
PROSITE profilePS5129419.93868122IPR017930Myb domain
SMARTSM007173.0E-1472120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-1976121IPR009057Homeodomain-like
CDDcd001673.03E-1076117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MQETRKKNGG NEDSKKKERH IVTWTQEEDD ILRGQISLHG TENWAIIASK FKDKTTRQCR  60
RRWYTYLNSD FKKGGWSPEE DMLLCEAQKV FGNRWTEIAK VVSGRTDNAV KNRFSTLCKK  120
RAKYEALAKE NTATCINPNN KRILLQNGFN LDGTADCTDS VKRMRRSHVS DLTENCNFGD  180
RSHRVSGTMM NQQLRHPFAV LGQNLRNANN VVVQSQVNNV KEVSNDAQDN STRGTFLRKD  240
DPKINALMQQ AELLSSLALK VNSDNTEQSL ENAWKMLQDF LNQSKENDIL RYTMSDIDLQ  300
LEDFKDLLED LRSSNEGSHP SWRQPDLYEA SPASSEYSTG STLMPHPAGE TGEEAQGKID  360
ELHQDMPSSH IGEQNCGSEE KRAVSGANTN LVDIITSCDD NTNNIVASTS SSIEFSSPIQ  420
VTPLFRSLAA GIPSPNFSES ERNFLLKTLG MESPSPNPGN NHSQPPPCKR VLLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-262412110107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.198710.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463171.10.0PREDICTED: pre-mRNA-splicing factor CEF1-like isoform X2
TrEMBLA0A0B0NQG40.0A0A0B0NQG4_G
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88